PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G007200.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 290aa    MW: 31596.5 Da    PI: 6.3442
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G007200.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.67.7e-103331748
                        HHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding 17 kqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          + +++W++Iar ++ gR++kqc++rw  yl
  Sevir.1G007200.4.p  3 DAHSSKDWSSIARAVP-GRSRKQCRDRWTHYL 33
                        5678889*********.***********9886 PP

2Myb_DNA-binding414.5e-134080244
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                        ++W+++E+  l++a+k +G++ W   a+ ++ gRt+k +k++w
  Sevir.1G007200.4.p 40 MPWSEQEEIDLIRAHKIHGNK-WCELAKFFP-GRTGKAIKNYW 80
                        68*******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001671.16E-7133No hitNo description
PROSITE profilePS5129411.422133IPR017930Myb domain
SMARTSM007173135IPR001005SANT/Myb domain
PfamPF002494.8E-8233IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-15239IPR009057Homeodomain-like
SuperFamilySSF466894.49E-241390IPR009057Homeodomain-like
PROSITE profilePS5129418.2473488IPR017930Myb domain
SMARTSM007176.4E-123886IPR001005SANT/Myb domain
PfamPF002496.7E-124080IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-194088IPR009057Homeodomain-like
CDDcd001676.08E-124180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MVDAHSSKDW SSIARAVPGR SRKQCRDRWT HYLDPAVNQM PWSEQEEIDL IRAHKIHGNK  60
WCELAKFFPG RTGKAIKNYW TGAMKKKIKS NLGSGSPEQL SPCPNDSLIP VGRDSTATSS  120
QDSSNNIPIS SADLPVRLKS KHGLTEACRN ACTLKEKGPD SIHDEGSIPH SVNVSQMVDG  180
RTVGSSLHIL TEEKLVSPLS SVDEKVSCVA ANSPKPLKEE ESTNFLEIPP ALSFQSSNVH  240
SDAICSSADP ESRQLHLASI ADLLDMSYCE SLMVIAPDST NDEDFKLGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2318821108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952183.15e-89PREDICTED: myb-related protein 3R-1-like
TrEMBLK3YUP10.0K3YUP1_SETIT; Uncharacterized protein
STRINGSi017987m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-34myb domain protein 3r-4